Tap / click on image to see more RealViewsTM
CA$83.55
per case
 

Glitch: achievement aONE comrade Case-Mate iPhone Case

Qty:
  1. Phone Model

  2. Style

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Tough Apple iPhone 11 Case

Simple, but tough. Contoured to fit the sleek curves of the iPhone, this Case-Mate case features a hard shell plastic exterior and shock absorbing liner to protect your device.

  • Designed for the Apple iPhone 11
  • Shock absorbing flexible liner for an added layer of protection
  • Impact resistant, durable hard plastic
  • Case will not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customize with your images, designs and text
  • Glossy finish
  • Printed in the USA

About This Design

Glitch: achievement aONE comrade Case-Mate iPhone Case

Glitch: achievement aONE comrade Case-Mate iPhone Case

Glitch: achievement aONE comrade This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5289 total 5-star reviews844 total 4-star reviews212 total 3-star reviews119 total 2-star reviews131 total 1-star reviews
6,595 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.January 29, 2022Verified Purchase
Zazzle Reviewer Program
It was very nice the pictures were placed the way i put them. the printing was fine
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan g.July 31, 2025Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Tough
Creator Review
I purchased this waterfall photo case as a birthday gift. The design was created from one of my images, and my friend loved it. This case is well-suited for individuals who find the sight of flowing water to be calming, as he found the vision therapeutic. It proved to be a perfect gift for someone who already has everything.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By VickiAugust 9, 2021Verified Purchase
Zazzle Reviewer Program
I received the cell phone case on the promised date. I loved the detail, colors, and the dragonfly on the case. The colors are vibrant and the details of the dragonfly were wonderful. Have received many compliments on the case.
from zazzle.com (US)
Original product

Tags

Casemate Cases
achievementaonecomradeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementaonecomradeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 179341079163020918
Designed on 2014-10-06, 12:23 PM
Rating: G