Tap / click on image to see more RealViewsTM
CA$83.60
per case
 

Glitch: achievement aONE comrade

4.5 out of 5 stars rating
171 Total Reviews |
by
Qty:

  1. Device Type

  2. Style

Other designs from this category

About Phone Cases

Sold by

Device Type: iPhone 17

Our iPhone 17 Tough Cases are designed for those who want added protection without the bulk. This dual-layered case features a durable polycarbonate outer shell with a cushioned inner TPU liner to guard against bumps, dings, and scratches. Using the latest 3D sublimation printing techniques, your design isn't just printed on the case, it becomes a permanent part of it. The high-resolution print fully wraps from edge to edge and is embedded underneath a protective, ensuring the vibrant colours resist scratching and fading over time. Plus, the case is lightweight and won't interfere with wireless charging.

  • Dual-layered construction with a polycarbonate shell and a cushioned TPU liner
  • Vibrant, full-wrap print that resists scratching, peeling, and fading
  • Offers moderate protection without the bulk of larger cases
  • MagSafe Compatible
Phone CaseCreate your own from scratch

About This Design

Glitch: achievement aONE comrade

Glitch: achievement aONE comrade This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!
GlitchenIn
Pro
Artwork designed by
View their Store

Customer Reviews

4.5 out of 5 stars rating171 Total Reviews
140 total 5-star reviews10 total 4-star reviews3 total 3-star reviews8 total 2-star reviews10 total 1-star reviews
171 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lori W.January 12, 2023 • Verified Purchase
iPhone 11 Slim Fit Case, Glossy
Zazzle Reviewer Program
This iPhone case turned out perfectly! You got my logo exact and it looks so great on my phone. It’s going to be a cool little way to advertise my business. Thank you so much!! Very happy with my purchase!! Will order from again! .
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jennifer J.May 10, 2021 • Verified Purchase
iPhone 11 Slim Fit Case, Glossy
Zazzle Reviewer Program
this was so fun and easy and quickly shipped! it looks just like the preview and i am thrilled. the only slight negative is this kind of case isn’t the easiest to get on and off. perfect! .............
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sami P.December 16, 2022 • Verified Purchase
iPhone 17 Tough Case, Glossy
Zazzle Reviewer Program
10/10 I LOVE IT! Thank you have a great Christmas!
from zazzle.com (US)

Tags

achievementaonecomradeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Glitch: achievement aONE comrade
Product ID: 179341079163020918
Designed on 2014-10-06, 12:23 p.m.
Rating: G