Tap / click on image to see more RealViewsTM
CA$32.30
per roll
 

Giftwrap: Jolly Santa Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 60lb, text weight matte paper
  • Softer surface with dull finish - ideal for color contrasts
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section

About This Design

Giftwrap:  Jolly Santa Wrapping Paper

Giftwrap: Jolly Santa Wrapping Paper

This giftwrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3434 total 5-star reviews381 total 4-star reviews120 total 3-star reviews74 total 2-star reviews108 total 1-star reviews
4,117 Reviews
Reviews for similar products
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
This is a great roll of wrapping paper. It's good for many occasions and can be used for him or hers gifts. I was looking for a gender neutral paper that I could use in my shop that also incorporated the color pink like our logo without it being too feminine. I believe we achieved that with this wrapping paper. The paper quality it excellent and we look forward to continuing with this design for years to come. Perfect, no printing streaks or lines like i have seen in some of the other papers I've ordered.
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
There isn't much to say about this paper other than it's perfect and gorgeous. I purchased the matte option and I'm glad I did, this paper has that boutique look and feel to it. Paper quality it top notch as well - thick and expensive looking. Thanks! Perfect, no lines or streaks, colors are vibrant and exactly as shown in the photos.
5 out of 5 stars rating
By L A.December 26, 2022Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Ordered this to wrap my geology-obsessed daughter’s Christmas gifts in. I love the selection of themes available! Love it, love the paper quality too and that it is recyclable

Tags

Wrapping Paper
santajollychristmasxmasvchdgiftwrapwrappaperwrapping
All Products
santajollychristmasxmasvchdgiftwrapwrappaperwrapping

Other Info

Product ID: 256561890783440174
Designed on 2018-08-21, 3:17 PM
Rating: G