Tap / click on image to see more RealViewsTM
CA$32.30
per roll
 

Gift Wrap - Two Kittens

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 60lb, text weight matte paper
  • Softer surface with dull finish - ideal for color contrasts
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section

About This Design

Gift Wrap - Two Kittens

Gift Wrap - Two Kittens

This gift wrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3431 total 5-star reviews381 total 4-star reviews119 total 3-star reviews74 total 2-star reviews105 total 1-star reviews
4,110 Reviews
Reviews for similar products
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
This is a great roll of wrapping paper. It's good for many occasions and can be used for him or hers gifts. I was looking for a gender neutral paper that I could use in my shop that also incorporated the color pink like our logo without it being too feminine. I believe we achieved that with this wrapping paper. The paper quality it excellent and we look forward to continuing with this design for years to come. Perfect, no printing streaks or lines like i have seen in some of the other papers I've ordered.
5 out of 5 stars rating
By V.October 18, 2023Verified Purchase
Zazzle Reviewer Program
There isn't much to say about this paper other than it's perfect and gorgeous. I purchased the matte option and I'm glad I did, this paper has that boutique look and feel to it. Paper quality it top notch as well - thick and expensive looking. Thanks! Perfect, no lines or streaks, colors are vibrant and exactly as shown in the photos.
5 out of 5 stars rating
By L A.December 26, 2022Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
I order Christmas wrapping paper every year from Zazzle for my daughters. One loves horses and each year I get a different print. This one was customizable with her name! She loved it. Great, love the paper too and that it is recyclable

Tags

Wrapping Paper
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby
All Products
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby

Other Info

Product ID: 256780920773533187
Designed on 2016-06-09, 1:30 PM
Rating: G