Tap / click on image to see more RealViewsTM
CA$6.45
per bumper sticker
 

Funny Keep Honking Vinyl Bumper Sticker

Qty:

Other designs from this category

About Bumper Stickers

Sold by

Style: Bumper Sticker

Entertain the cars sitting behind you in traffic with a custom bumper sticker. Make your car a reflection of you and your personality, show off your particular politics, or brag about your honor roll child! Get your point across with this quality bumper sticker that will outlast heavy rain, intense sunlight, and the most severe of traffic jams.

  • Dimensions: 3"l x 11"w
  • Made from durable white vinyl with a strong adhesive back that will hold up under the most severe of conditions
  • Please note, stickers are fully printed and are not translucent or clear
  • 100% weatherproof
  • Printed with water-resistant ink that won’t fade or run

About This Design

Funny Keep Honking Vinyl Bumper Sticker

Funny Keep Honking Vinyl Bumper Sticker

Add some sarcasm to your ride with our "Keep Honking, I Love Meaningless Feedback" vinyl bumper sticker – the perfect way to express your dry wit while stuck in traffic. This funny bumper sticker is ideal for drivers who appreciate a little roadside humour and aren’t afraid to show it. Crafted from durable, weatherproof vinyl, this high-quality car sticker is designed to withstand sun, rain, and whatever else the road throws at it. Whether you’re commuting, road-tripping, or just parked at the grocery store, this funny vinyl decal will definitely turn heads and spark a few chuckles. Perfect for: 🚗 Cars, trucks, and SUVs 💻 Laptops, water bottles, toolboxes 🎁 Gag gifts, stocking stuffers, or white elephant exchanges Product Features: Bold black & white design for maximum readability Easy peel-and-stick application Removable without residue Measures approx. 8" x 3" Show the world you’ve got a sense of humour (and a little bit of sass) with this hilarious bumper sticker. Because let’s face it—honking rarely helps, but sarcasm always does.

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3135 total 5-star reviews323 total 4-star reviews61 total 3-star reviews34 total 2-star reviews34 total 1-star reviews
3,587 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rebecca M.March 22, 2019Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
Ordered this to put on my laptop at my liberal arts university, to show my true colours. It came exactly as described, it came undamaged and packed well, and it shipped quickly from the US to Canada. It was a little difficult to remove from its paper backing but otherwise I had no trouble with it. Clear, the colours were bright, and the text wasn't blurry at all. The red especially was vibrant and not faded-looking or patchy.
5 out of 5 stars rating
By T.March 30, 2021Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
The product works very well. Zazzle delivered it in a sturdy packaging, with a special folder for the sticker so it wouldn't bend in the mail or anything, which I appreciate. Sticks well to the car, and looks good! The image quality and colour all looks good to me. Up close and afar, I see no problems with it.
5 out of 5 stars rating
By Cindy O.September 22, 2023Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
love that I can say my daughter is a cancer survivor - true warrior and be able to have that on my car so everyone knows. colour is vibrant, looks great on my VW

Tags

Bumper Stickers
funnybumperstickersarcasticcardecalvinylkeephonkingwitty
All Products
funnybumperstickersarcasticcardecalvinylkeephonkingwitty

Other Info

Product ID: 256615977567618302
Designed on 2025-06-01, 5:01 AM
Rating: G