Tap / click on image to see more RealViewsTM
CA$8.85
per sticker
 

Fun White Bride Groom Wedding Planner

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner sticker set

Customer Reviews

4.2 out of 5 stars rating204 Total Reviews
146 total 5-star reviews15 total 4-star reviews10 total 3-star reviews10 total 2-star reviews23 total 1-star reviews
204 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.April 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
User friendly made ordering easy. Quick turnaround time. Super pleased with the clear labels and script. I have the best dressed invitation envelopes and have received numerous compliments. Would definitely recommend and buy again. Excellent quality would highly recommend.
4.0 out of 5 stars rating
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Beautiful font and printing - only "downsize" was it was very difficult to estimate the size of the labels from the website. The extra-large labels are very big. Design and quality of printing is very good.
4.0 out of 5 stars rating
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Very good quality and durability - personally, I found it very difficult to judge the size of the labels from the website and ended up order extra-large, they are incredibly big. Good printing and image quality.

Tags

Custom-Cut Vinyl Stickers
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral
All Products
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral

Other Info

Product ID: 256170842373066873
Designed on 2022-08-15, 11:47 AM
Rating: G