Tap / click on image to see more RealViewsTM
CA$6.25
per sticker
 

Fun White Bride Groom Wedding Planner

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm L x 11.43 cm H
  • Design Area: 10.16 cm L x 10.16 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner sticker set

Customer Reviews

4.4 out of 5 stars rating178 Total Reviews
133 total 5-star reviews15 total 4-star reviews9 total 3-star reviews5 total 2-star reviews16 total 1-star reviews
178 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.April 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
User friendly made ordering easy. Quick turnaround time. Super pleased with the clear labels and script. I have the best dressed invitation envelopes and have received numerous compliments. Would definitely recommend and buy again. Excellent quality would highly recommend.
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Very good quality and durability - personally, I found it very difficult to judge the size of the labels from the website and ended up order extra-large, they are incredibly big. Good printing and image quality.
4 out of 5 stars rating
By Marlies F.March 4, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Beautiful font and printing - only "downsize" was it was very difficult to estimate the size of the labels from the website. The extra-large labels are very big. Design and quality of printing is very good.

Tags

Custom-Cut Vinyl Stickers
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral
All Products
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral

Other Info

Product ID: 256170842373066873
Designed on 2022-08-15, 11:47 AM
Rating: G