Tap / click on image to see more RealViewsTM
CA$60.40
per window cling
 

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Qty:
45.7cm x 45.7cm
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colours vivid

Adhesive: Cling art faces outwards

Adhesive side is on the front of the window cling. All text and art is printed on the front of the window cling and faces away from the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the opposite side of the window that it has been applied to.

About This Design

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Forest Wolf Night Sky Wilderness Animal Art Window Cling

Customer Reviews

3.6 out of 5 stars rating231 Total Reviews
132 total 5-star reviews13 total 4-star reviews8 total 3-star reviews16 total 2-star reviews62 total 1-star reviews
231 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Evgeny P.November 6, 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)
1.0 out of 5 stars rating
1 out of 5 stars rating
By Amanda C.September 17, 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
The design came out very nice but the product comes where the clear back clings to the surface where I wanted just the letters and design to cling to the surface NOT the actual clear backing with a square. If the designer sees this review can you contact me? I would like to re-order with the correct product I want. .
2.0 out of 5 stars rating
2 out of 5 stars rating
By Brianna L.June 13, 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut, Display: Back of Cling, Window Cling
Printing quality wasn't great, seemed a bit blurry.

Tags

Window Clings
forest wolf night skywilderness animal art window clingforestwolfnightskywildernessanimalartwindow
All Products
forest wolf night skywilderness animal art window clingforestwolfnightskywildernessanimalartwindow

Other Info

Product ID: 256973010613971893
Designed on 2023-11-20, 2:52 PM
Rating: G