Tap / click on image to see more RealViewsTM
CA$12.60
CA$2.10 per coaster
 

First Fibonacci Plaid Square Paper Coaster

Qty:
Square
+CA$0.05
+CA$0.05
+CA$0.05
+CA$0.05
+CA$0.05
+CA$0.05
+CA$0.05
+CA$0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customizable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Square Dimensions: 10 cm x 10 cm (4" x 4").
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, absorbent and perfect for parties, weddings or branding your business.

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.8 out of 5 stars rating616 Total Reviews
513 total 5-star reviews77 total 4-star reviews14 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
616 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.April 3, 2022Verified Purchase
Square Coasters
Zazzle Reviewer Program
The price, the quality and the timeliness of the product arriving: 5 stars! I loved that I could design my own coaster and it came on time! These are my wedding favours and I'm loving them! Everything was clear and beautiful!
5 out of 5 stars rating
By D.November 29, 2020Verified Purchase
Square Coasters
Zazzle Reviewer Program
The coasters are well worth every penny. If you want to add that special touch to your tables inside or outside I would highly recommend to place an order. You won’t be disappointed. Can’t beat the price. I ordered these coasters to use in our tiki bar. The colours are so bright and will look amazing in our tiki bar in the summer. Can’t hardly wait to use them in the summer time. I’m going to order another set for around our fire pit table.
5 out of 5 stars rating
By D.November 29, 2020Verified Purchase
Zazzle Reviewer Program
I found the coasters a bit thin, however they are very durable and great quality. I would order another set in a heart beat. Can’t beat the price and the overall personal look adds that nice touch to any room. The coasters turned out perfect. The colours matched my Christmas theme colours. I have them displayed on my table.
Original product

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 256165514977023455
Designed on 2016-03-01, 10:14 AM
Rating: G