Tap / click on image to see more RealViewsTM
Sale Price CA$51.26.  
Original Price CA$60.30 per tie
You save 15%

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139.7 cm
      • Width: 10.2 cm (at widest point)
    • Printed in vibrant full color
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
    • Dry clean only

    About This Design

    First Fibonacci Plaid Nerdy Math Tartan Tie

    First Fibonacci Plaid Nerdy Math Tartan Tie

    Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1852 total 5-star reviews331 total 4-star reviews146 total 3-star reviews76 total 2-star reviews124 total 1-star reviews
    2,529 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Margo N.July 8, 2023 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Valta L.August 16, 2020 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Valta L.August 16, 2020 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much and the print turned out so nice, exactly as I designed it and it was not raised, it looked as though it was part of the overall fabric itself! It was so cool!

    Tags

    fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

    Other Info

    Product ID: 151220032616911856
    Designed on 2016-02-20, 12:52 PM
    Rating: G