Tap / click on image to see more RealViewsTM
CA$43.85
per tie
 

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139.7 cm
    • Width: 10.2 cm (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

First Fibonacci Plaid Nerdy Math Tartan Tie

First Fibonacci Plaid Nerdy Math Tartan Tie

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1811 total 5-star reviews328 total 4-star reviews136 total 3-star reviews69 total 2-star reviews101 total 1-star reviews
2,445 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margo N.July 8, 2023Verified Purchase
Tie
Zazzle Reviewer Program
That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
1 out of 5 stars rating
By L.January 22, 2026Verified Purchase
Tie
The tie was shown as being black and white on the website but unfortunately it is green and white once I received it. This is false advertisement and I am reporting it. I want my money back. I'm willing to return the tie. It's no good. .
5 out of 5 stars rating
By Laura V.August 16, 2020Verified Purchase
Tie
Zazzle Reviewer Program
I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!

Tags

Ties
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 151220032616911856
Designed on 2016-02-20, 12:52 PM
Rating: G