Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.
CA$47.65
per binder
 

Faux Rose Gold Foil Look Butterfly & Custom Text Binder

Qty:
Enter Information
3.81 cm Paper Capacity
+CA$4.25

Other designs from this category

About folders

Sold by

Size: Avery Signature 3.8 cm Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 25.4 cm w x 29.84 cm l; Spine: 5.58 cm
  • 3-ring binder designed for letter (21.59 cm x 27.94 cm) sized paper
  • 3.81 cm capacity, fits 400 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

2.5 cm Capacity: 275 pages
3.8 cm Capacity: 400 pages
5.1 cm Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.
Faux Rose Gold Foil Look Butterfly & Custom Text Binder

Faux Rose Gold Foil Look Butterfly & Custom Text Binder

Lovely butterfly shape in faux (not real) rose gold foil look-like texture. The butterfly is place as a large motif in the middle and as smaller motifs in each corner. There are also personalizable text areas on the front and on the spine. NOTICE: THE DESIGN IS A DIGITAL IMAGE AND IT WILL BE PRINTED ON THE PRODUCT.

Customer Reviews

4.7 out of 5 stars rating6.5K Total Reviews
5552 total 5-star reviews614 total 4-star reviews154 total 3-star reviews96 total 2-star reviews107 total 1-star reviews
6,523 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jacqueline O.December 24, 2021Verified Purchase
Avery Signature Binder, 2.54 cm Paper Capacity
Zazzle Reviewer Program
A gift for my best friend from childhood. The personalization was an excellent feature. The colors looked exactly as I expected. Printing was perfect.
5 out of 5 stars rating
By M.November 1, 2020Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
I just love the look and quality of my new cookbook. The printing job was exceptional.
5 out of 5 stars rating
By G.December 26, 2021Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
The binder is going to be awesome for my purposes of storing kpop photocards! The printing was super clear and pretty!

Tags

folders
rose gold butterflyrose gold foil butterflybutterflypink butterflyfaux foil butterflygirlyfeminineelegantpinkchic
All Products
rose gold butterflyrose gold foil butterflybutterflypink butterflyfaux foil butterflygirlyfeminineelegantpinkchic

Other Info

Product ID: 127677546342198148
Designed on 2021-07-04, 4:06 AM
Rating: G