Tap / click on image to see more RealViewsTM
Sale Price CA$31.50.  
Original Price CA$42.00 per pack of 100
You save 25% ends today

Farmers Market Organic Fresh Eggs Chicken Business Card

Qty:
Squared
+CA$10.55
Signature Matte

17.5 pt thickness / 324 GSM weight
Light eggshell white, uncoated matte finish

+CA$10.05
+CA$10.05
+CA$10.05
+CA$20.05
+CA$20.05
+CA$20.05

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: Canadian Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

A classic, all around paper with a natural feel and an uncoated matte finish; our Standard Matte stands the test of time. Elegant and understated, colours print softer and more subtle.

  • 17.5 pt thickness / 324 GSM weight
  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating39K Total Reviews
32692 total 5-star reviews3886 total 4-star reviews964 total 3-star reviews588 total 2-star reviews859 total 1-star reviews
38,989 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lori B.May 18, 2022Verified Purchase
Business Card, Size: Canadian Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The cards turned out lovely! Just enough colour and design to look good and be easy to read . Sturdy card stock as well. The soft pink watercolour looks really pretty on it! Printing is very nice. It’s clear and well designed
5 out of 5 stars rating
By Marie S.July 2, 2022Verified Purchase
Business Card, Size: Mighty, 3.5" x 2.5",Paper: Signature Matte, Corners: Rounded
Zazzle Reviewer Program
I am so happy with these custom earring card backs. The process of designing then was easy and straightforward. There was an error with my initial order due and they refunded me and printed again right away. My cards are sleek, professional and perfect for my small business. They arrive promptly. I am very pleased to also be supporting other independent creatives like myself.. The print quality was exceptional!
5 out of 5 stars rating
By Carmen R.December 10, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I'm super happy with my cards I always get compliments on them. No complaints they are perfect!!

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Designed on 2024-06-21, 1:10 PM
Rating: G