Tap / click on image to see more RealViewsTM
CA$54.75
per binder
 

Falln Gregorian Maiden Binder

Qty:
Heads-up!
Sorry, this product is completely sold out.
  1. Size

  2. Inside Colour

Other designs from this category

About folders

Sold by

Size: Avery Signature 5.1 cm Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 25.4 cm w x 29.84 cm l; Spine: 7.11 cm
  • 3-ring binder designed for letter (21.59 cm x 27.94 cm) sized paper
  • 5.08 cm capacity, fits 540 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

2.5 cm Capacity: 275 pages
3.8 cm Capacity: 400 pages
5.1 cm Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Falln Gregorian Maiden Binder

Falln Gregorian Maiden Binder

A gorgeous book cover from the 1600's that fell into public domain. I did digital restoration work on it, brought back the colours it once had, and made it into the beautiful art piece it is now. I left the antiqued look it has gained over the years, because I felt it added to the beauty.

Customer Reviews

4.7 out of 5 stars rating6.8K Total Reviews
5728 total 5-star reviews634 total 4-star reviews171 total 3-star reviews121 total 2-star reviews157 total 1-star reviews
6,811 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ruth T.April 12, 2024Verified Purchase
Avery Signature Binder, 2.5 cm
I love my antique looking binder. It is durable and can take a lot of paper. Each one of my families will have approximately 500 pages. The design looks like an antique book. I can't wait to put this binder on display.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jacqueline O.December 24, 2021Verified Purchase
Avery Signature Binder, 2.5 cm
Zazzle Reviewer Program
A gift for my best friend from childhood. The personalization was an excellent feature. The colors looked exactly as I expected. Printing was perfect.
4.0 out of 5 stars rating
4 out of 5 stars rating
By BrieFebruary 11, 2021Verified Purchase
Avery Signature Binder, 2.5 cm
Zazzle Reviewer Program
It's very pretty, and it arrived on time, but the inside corner on the front cover is torn. I'm still going to use it, I'll be honest, but for the price I paid, not so good and it's disappointing... The printing is beautiful.

Tags

folders
gregoriancelticmedievalfantasypaganspellsspellbookofshadowsmagickgrimoire
All Products
gregoriancelticmedievalfantasypaganspellsspellbookofshadowsmagickgrimoire

Other Info

Product ID: 127872599815015945
Designed on 2016-09-20, 9:26 PM
Rating: G