Tap / click on image to see more RealViewsTM
CA$50.30
per binder
 

Falln Gregorian Maiden Binder

Qty:
3.81 cm Paper Capacity
+CA$4.50

Other designs from this category

About folders

Sold by

Size: Avery Signature 3.8 cm Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 25.4 cm w x 29.84 cm l; Spine: 5.58 cm
  • 3-ring binder designed for letter (21.59 cm x 27.94 cm) sized paper
  • 3.81 cm capacity, fits 400 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

2.5 cm Capacity: 275 pages
3.8 cm Capacity: 400 pages
5.1 cm Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Falln Gregorian Maiden Binder

Falln Gregorian Maiden Binder

A gorgeous book cover from the 1600's that fell into public domain. I did digital restoration work on it, brought back the colours it once had, and made it into the beautiful art piece it is now. I left the antiqued look it has gained over the years, because I felt it added to the beauty.

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5600 total 5-star reviews622 total 4-star reviews158 total 3-star reviews101 total 2-star reviews113 total 1-star reviews
6,594 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jacqueline O.December 24, 2021Verified Purchase
Avery Signature Binder, 2.54 cm Paper Capacity
Zazzle Reviewer Program
A gift for my best friend from childhood. The personalization was an excellent feature. The colors looked exactly as I expected. Printing was perfect.
5 out of 5 stars rating
By M.November 1, 2020Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
I just love the look and quality of my new cookbook. The printing job was exceptional.
5 out of 5 stars rating
By G.December 26, 2021Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
The binder is going to be awesome for my purposes of storing kpop photocards! The printing was super clear and pretty!

Tags

folders
gregoriancelticmedievalfantasypaganspellsspellmagicbookofshadowsmagick
All Products
gregoriancelticmedievalfantasypaganspellsspellmagicbookofshadowsmagick

Other Info

Product ID: 127646986296271292
Designed on 2016-05-01, 10:25 AM
Rating: G