Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$50.30
per binder
 

Falln Gregorian Maiden Binder

4.7 out of 5 stars rating
6741 Total Reviews |
by
Qty:
Size
2.54 cm Paper Capacity
+CA$4.50

Other designs from this category

About folders

Sold by
folderCreate your own from scratch

Size: Avery Signature 2.5 cm Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 25.4 cm w x 29.84 cm l; Spine: 3.55 cm
  • 3-ring binder designed for letter (21.59 cm x 27.94 cm) sized paper
  • 2.54 cm capacity, fits 275 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

2.5 cm Capacity: 275 pages
3.8 cm Capacity: 400 pages
5.1 cm Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Falln Gregorian Maiden Binder

Falln Gregorian Maiden Binder

A gorgeous book cover from the 1600's that fell into public domain. I did digital restoration work on it, brought back the colours it once had, and made it into the beautiful art piece it is now. I left the antiqued look it has gained over the years, because I felt it added to the beauty.
FallnAngel Creations
Bronze
Artwork designed by
Utah, United States
View their Store

Customer Reviews

4.7 out of 5 stars rating6.7K Total Reviews
5692 total 5-star reviews627 total 4-star reviews169 total 3-star reviews113 total 2-star reviews140 total 1-star reviews
6,741 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jacqueline O.December 24, 2021 • Verified Purchase
Avery Signature Binder, 2.54 cm Paper Capacity
Zazzle Reviewer Program
A gift for my best friend from childhood. The personalization was an excellent feature. The colors looked exactly as I expected. Printing was perfect.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Agnes C.January 8, 2018 • Verified Purchase
Avery Signature Binder, 5.08 cm Paper Capacity
Zazzle Reviewer Program
The photo album is as described. The pictures and text that were added to the front, back and spine were as ordered. The process of adding pictures and changing colour, size and font of text was easy to edit when ordering the customized binder. The binder was sturdy making it easy to insert three-ring photo pages. The pockets on the inside of the binder cover were used to insert a disc of the pictures in the binder. The final product turned out great. the pictures and text were printed as shown in the edited preview copy when ordering. Even though there was a warning that one of the pictures may be fuzzy, it turned out to be fine. The product was ordered for a Christmas gift and the customized binder was completed and shipped in time for Christmas. It was appreciated as a personalized gift.
5.0 out of 5 stars rating
5 out of 5 stars rating
By G.December 26, 2021 • Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
The binder is going to be awesome for my purposes of storing kpop photocards! The printing was super clear and pretty!

Tags

folders
gregoriancelticmedievalfantasypaganspellsspellmagicbookofshadowsmagick
All Products
gregoriancelticmedievalfantasypaganspellsspellmagicbookofshadowsmagick

Other Info

Product ID: 127597510774646182
Designed on 2016-03-11, 1:04 AM
Rating: G