Tap / click on image to see more RealViewsTM
CA$5.37
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.91
+CA$0.91
-CA$0.24

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 5" x 7"

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 5" x 7" (portrait); 7" x 5" (landscape)
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.6K Total Reviews
16563 total 5-star reviews726 total 4-star reviews121 total 3-star reviews61 total 2-star reviews117 total 1-star reviews
17,588 Reviews
Reviews for similar products
5 out of 5 stars rating
By Debra J.April 17, 2024Verified Purchase
Folded Greeting Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Really pleased with the card quality. The perfect theme to personalize a birthday celebration. Birthday greeting combined with a Christmas wish for my nieces Christmas Birthday. Perfect! These colours really pop on this Matte finish. The cute funny monkey expressions add humour to a birthday card surprise.
5 out of 5 stars rating
By AnonymousOctober 1, 2025Verified Purchase
Folded Greeting Card, Size: Big, 8.5" x 11", Paper: Signature Matte, Envelopes: White
I absolutely love this!! Thank you so much for creating a very special birthday card for my mom for her very special day!
5 out of 5 stars rating
By Stacey V.May 5, 2023Verified Purchase
Folded Greeting Card, Size: Small, 4" x 5.6", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This card is beautiful. I loved that I could pick special poems that mean something to me and will mean so much to my friend who lost her pet soul mate. The picture and the poems I requested turned out Purrfect! I will definitely be back to place more orders with this seller. Thank you for the amazing work you do!!

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Designed on 2019-03-19, 9:05 PM
Rating: G