Tap / click on image to see more RealViewsTM
CA$5.37
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.91
+CA$0.91
-CA$0.24

Other designs from this category

About Folded Greeting Cards

Sold by

Size: 12,7 × 17,8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating18.4K Total Reviews
17291 total 5-star reviews756 total 4-star reviews141 total 3-star reviews76 total 2-star reviews179 total 1-star reviews
18,443 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kenneth N.May 16, 2026Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Love this card! My Nephew's 60th Birthday, and I was able to add my own verse inside. Beautiful setup, and I thoroughly recommend Zazzle...
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra J.April 17, 2024Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Really pleased with the card quality. The perfect theme to personalize a birthday celebration. Birthday greeting combined with a Christmas wish for my nieces Christmas Birthday. Perfect! These colours really pop on this Matte finish. The cute funny monkey expressions add humour to a birthday card surprise.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kenneth N.May 12, 2026Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
I wanted a personal Birthday card for a dear friend who was turning 84. I was very pleased with the design and the message inside the card. I'm very pleased with the results, and certainly will order Zazzle cards in the future. I certainly recommend these beautiful cards...

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Designed on 2019-03-19, 9:05 PM
Rating: G