Tap / click on image to see more RealViewsTM
Sale Price CA$4.03.  
Original Price CA$5.37 per card
You save 25%

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.91
+CA$0.91
-CA$0.24

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.7K Total Reviews
16694 total 5-star reviews733 total 4-star reviews124 total 3-star reviews65 total 2-star reviews131 total 1-star reviews
17,747 Reviews
Reviews for similar products
5 out of 5 stars rating
By Debra J.April 17, 2024Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Really pleased with the card quality. The perfect theme to personalize a birthday celebration. Birthday greeting combined with a Christmas wish for my nieces Christmas Birthday. Perfect! These colours really pop on this Matte finish. The cute funny monkey expressions add humour to a birthday card surprise.
5 out of 5 stars rating
By Kenneth N.January 10, 2026Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
I needed a nice looking 90th Birthday card for a very dear friend. I selected the sample that would work for me, and added the name. I was so surprised on the fast delivery, and very pleased with the results. My card looked so much richer than on the web-site. Such an original, great looking 90th birthday card. I will be definitely ordering more cards in the next little while. I certainly recommend Zazzle products. Amazing designs...
5 out of 5 stars rating
By AnonymousOctober 1, 2025Verified Purchase
Folded Greeting Card, Size: Big, 21.6 cm x 28 cm, Paper: Signature Matte, Envelopes: White
I absolutely love this!! Thank you so much for creating a very special birthday card for my mom for her very special day!

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Designed on 2019-03-19, 9:05 PM
Rating: G