Tap / click on image to see more RealViewsTM
CA$10.55
per set of 6 labels
 

Experience the Beauty of a Blue Sky with a Plane Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-CA$1.75
-CA$3.55
+CA$7.10
+CA$7.10
+CA$7.10
+CA$7.10
+CA$7.10

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Experience the Beauty of a Blue Sky with a Plane Wine Label

Experience the Beauty of a Blue Sky with a Plane Wine Label

Discover the serene beauty of a clear blue sky as an aircraft soars through the clouds on a sunny day. Witness the magic of aviation and travel in the vast sky.

Customer Reviews

4.8 out of 5 stars rating146 Total Reviews
130 total 5-star reviews9 total 4-star reviews2 total 3-star reviews2 total 2-star reviews3 total 1-star reviews
146 Reviews
Reviews for similar products
5 out of 5 stars rating
By Loredana G.June 28, 2023Verified Purchase
Water Bottle Label (21 cm x 5.4 cm)
Zazzle Reviewer Program
These turned out great for my daughter's bridal shower. I removed the paper label from the bottle and attached this sticker. Printing is beautiful.
5 out of 5 stars rating
By Rita D.November 10, 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I bought these labels for my candle jars and they were perfect! Good quality. Able to peel them off without residue on the jar. Nice matte finish. Perfect! Exactly what was ordered
4 out of 5 stars rating
By S.December 23, 2023Verified Purchase
Zazzle Reviewer Program
originally, I loved the look of this product when I first received it however, I have changed my packaging and I’m now going to re-order a darker set of labels. This would look very nice on amber glass bottles however I am going to be using a metal bottle and the background doesn’t match with this and this is the reason for my re ordering. The printing turned out lovely. I added some colour in mine, and I wish that I had made the yellow, a little bit more of a Golden yellow as opposed to a pale yellow. (attached picture). However, I think the darker orange turned out lovely.

Tags

Food and Beverage Label Sets
blue skyplaneflyingskyaircraftaviationcloudssunny daytravelhorizon
All Products
blue skyplaneflyingskyaircraftaviationcloudssunny daytravelhorizon

Other Info

Product ID: 256692514442163611
Designed on 2024-04-14, 8:42 AM
Rating: G