Tap / click on image to see more RealViewsTM
CA$10.75
per sheet of 20
 

Elf with White Cat Riding on a Leaf Stickers 2

Qty:
Square Stickers
+CA$0.50
+CA$0.50
+CA$0.50

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" L x 3" W, 6 stickers per sheet
    • Small: 1.5" L x 1.5" W, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf with White Cat Riding on a Leaf Stickers 2

Elf with White Cat Riding on a Leaf Stickers 2

these are lovely for your scrapbooking projects - to label items - or just envelope seals... © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating26.9K Total Reviews
23376 total 5-star reviews2219 total 4-star reviews540 total 3-star reviews322 total 2-star reviews474 total 1-star reviews
26,931 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tracey M.October 5, 2020Verified Purchase
Zazzle Reviewer Program
Entire process was quick simple to choose & product arrived before anticipated as well it was a elegant touch as a label to a party favour so happy! Design was perfect as in picture when ordering
5 out of 5 stars rating
By R.April 9, 2021Verified Purchase
Zazzle Reviewer Program
Love our thank you stickers we are using for our gifts. They are exactly what we ordered and the quality is fantastic. Printing was excellent and clear. Couldn’t be happier
5 out of 5 stars rating
By Katie O.December 9, 2024Verified Purchase
Love my stickers. The entire process was so easy from creation to paying to shipping. I love that all my orders are saved and easy to access to re-order or re-design. The prices are reasonable too. There's a lot of complications in marketing a business. Zazzle isn't one of them. .

Tags

Stickers
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful
All Products
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful

Other Info

Product ID: 217199683751234378
Designed on 2011-10-11, 1:03 PM
Rating: G