Tap / click on image to see more RealViewsTM
CA$12.75
per sticker
 

Elephants Black and White Line Art

Qty:
Enter Information

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 20.32 cm x 20.32 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 20.32 cm L x 21.59 cm H
  • Design Area: 20.32 cm L x 20.32 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Elephants Black and White Line Art

Elephants Black and White Line Art

Cute and intricate line drawings of decorated Elephants.

Customer Reviews

4.9 out of 5 stars rating39 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
39 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5 out of 5 stars rating
By Terra P.November 9, 2020Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!
5 out of 5 stars rating
By M.June 14, 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.

Tags

Custom-Cut Vinyl Stickers
nic squirrellcuteline artdrawingintricateblack and whiteelephantpachydermanimalwildlife
All Products
nic squirrellcuteline artdrawingintricateblack and whiteelephantpachydermanimalwildlife

Other Info

Product ID: 256068040920987421
Designed on 2021-09-02, 2:55 AM
Rating: G