Tap / click on image to see more RealViewsTM
CA$88.90
per set of 50 napkins
 

Elegant Thanksgiving Pear Wreath Illustration Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalized paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Napkin

Elegant Thanksgiving Pear Wreath Illustration Napkin

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.6 out of 5 stars rating106 Total Reviews
85 total 5-star reviews10 total 4-star reviews4 total 3-star reviews2 total 2-star reviews5 total 1-star reviews
106 Reviews
Reviews for similar products
3 out of 5 stars rating
By Judy F.July 19, 2018Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
product on photo is really beautiful - and expensive too. item arrived yesterday and was shipped in a box that did not fit the napkin size right - therefore the napkins are all bumpy and creased now - not flat and smooth the way a napkin should lay. Also the printing is not centered to the napkin and all - and looks very poor. see images attached. I am very disappointed - as these were very expensive napkins. printing is not centered to the napkin. - entire glitter square is not straight -- looks awful!!! see images attached.
from zazzle.com (US)
5 out of 5 stars rating
By Christy H.May 23, 2024Verified Purchase
Paper Napkins, Standard Cocktail
These napkins were so cute and added a special touch for my granddaughter’s first birthday. We had our cake match these napkins. They arrived with fairly quick shipping. Printing was clean and exactly as pictured.
from zazzle.com (US)
5 out of 5 stars rating
By leslie i.August 20, 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
The cocktail napkins are exactly what I was looking for. The paper is smooth and untextured so there is no element challenging the logo placement. The print color came out perfectly. I was happy to get these and they arrived on time. Friday they will star in a Sweets & Bubbles reception for my art show opening. Perfect printing. The color is vivid and I'm glad I was able to position the logo anywhere I wanted to.
from zazzle.com (US)

Tags

Paper Napkins
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256037812667762383
Designed on 2020-11-01, 6:06 AM
Rating: G