Tap / click on image to see more RealViewsTM
CA$29.20
per towel
 

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Elegant Thanksgiving Pear Wreath Illustration Kitchen Towel

Modern Thanksgiving Wreath Fall Motif Towel

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1038 total 5-star reviews121 total 4-star reviews39 total 3-star reviews14 total 2-star reviews16 total 1-star reviews
1,228 Reviews
Reviews for similar products
5 out of 5 stars rating
By a.December 31, 2021Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
I was actually surprised by the quality. The material feels like it can handle the wash and the print seems to be set deep in the fibers. BUT I have not washed it yet. The printing was accurate and looks like it can handle washing.
5 out of 5 stars rating
By Pamela B.September 22, 2019Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Supper quality, quick Delivery people love them. Perfect, the quality and colour are wonderful
5 out of 5 stars rating
By Pamela B.November 29, 2019Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
This tea towel was sold before I could take it to a show. Colours are wonderful ordered 2 more

Tags

Kitchen Towels
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 197652513096200298
Designed on 2020-11-01, 7:18 AM
Rating: G