Tap / click on image to see more RealViewsTM
CA$29.20
per keychain
 

Elegant Thanksgiving Pear Wreath Illustration Keychain

Qty:
Square (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Square (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensions: 4.7 cm x 4.7 cm (1.875" x 1.875")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 4.7 cm x 4.7 cm (1.875" x 1.875"). For best results please add 0.15 cm (.12") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Keychain

Elegant Thanksgiving Pear Wreath Illustration Keychain

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating979 Total Reviews
866 total 5-star reviews79 total 4-star reviews14 total 3-star reviews7 total 2-star reviews13 total 1-star reviews
979 Reviews
Reviews for similar products
5 out of 5 stars rating
By Samantha M.May 6, 2023Verified Purchase
Acrylic Keychain, Square (single-sided)
Zazzle Reviewer Program
Turned out super cute! My husband loves it. The pictures were very clear and looked amazing
5 out of 5 stars rating
By J.August 13, 2024Verified Purchase
I adore the sentiment behind this keychain, which is why I chose it as a gift. This keychain features a beautifully polished, shiny finish.
from zazzle.com (US)
Original product
4 out of 5 stars rating
By Grace C.August 19, 2023Verified Purchase
Acrylic Keychain, Square (single-sided)
Zazzle Reviewer Program
It is simple, nothing too worrying about this except it is only one side. It still looks good though and is light and not to heavy. I like the AE2 artwork on it as it really takes it to another level. Definitely advise using high resolution logos, it does not have a pixelated look when you look at the detail in the lines and looks good for what it is.
from zazzle.com (US)

Tags

Key Chains
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256155350948813937
Designed on 2020-11-01, 6:35 AM
Rating: G