Tap / click on image to see more RealViewsTM
CA$13.90
per window cling
 

Elegant Script Pink 2 Initial Monogram Name Title Window Cling

Qty:
Enter Information
[10.5000,5.0000]
Automatic Opaque Design: White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 4” x 4” to a max of 52” x 72” (or max 72” x 52” if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colours vivid

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Elegant Script Pink 2 Initial Monogram Name Title Window Cling

Elegant Script Pink 2 Initial Monogram Name Title Window Cling

Classically femininewindow cling with your initials in pink under your name in an ornate, elegant script and title in a classic black font. A simple yet tasteful divider between them. A classy window cling for your glass door at your office personalized with name, initial, and profession.

Customer Reviews

3.7 out of 5 stars rating195 Total Reviews
116 total 5-star reviews11 total 4-star reviews7 total 3-star reviews9 total 2-star reviews52 total 1-star reviews
195 Reviews
Reviews for similar products
1 out of 5 stars rating
By Amanda C.September 17, 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
The design came out very nice but the product comes where the clear back clings to the surface where I wanted just the letters and design to cling to the surface NOT the actual clear backing with a square. If the designer sees this review can you contact me? I would like to re-order with the correct product I want. .
2 out of 5 stars rating
By Brianna L.June 13, 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut, Display: Back of Cling, Window Cling
Printing quality wasn't great, seemed a bit blurry.
5 out of 5 stars rating
By PCS I.October 3, 2025Verified Purchase
Style: Opaque Design: All-over White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Wow these are great. Great quality, great price, and great look ! The "cling" works great, put these up weeks ago and they still are "clung" with no issues whatsoever!! We'll done! A+.
from zazzle.com (US)

Tags

Window Clings
cleanmonogramelegantclassicprofessionalscriptdividerpinkfemininepretty
All Products
cleanmonogramelegantclassicprofessionalscriptdividerpinkfemininepretty

Other Info

Product ID: 256228764042361086
Designed on 2025-04-09, 12:21 PM
Rating: G