Tap / click on image to see more RealViewsTM
Sale Price CA$3.06.  
Original Price CA$4.08 per card
You save 25%

Elegant Script Botanical Christmas Photo Collage Holiday Card

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.30

Other designs from this category

About Flat Holiday Cards

Sold by

Size: 12.7 cm x 17.8 cm

Spread joy, share cheer, merry everything and a happy always! Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add photos and text for no additional charge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Script Botanical Christmas Photo Collage Holiday Card

Elegant Script Botanical Christmas Photo Collage Holiday Card

This multi-photo Christmas holiday card is a perfect choice this Christmas season! It features a photo collage of three favourite family photos on the top. Underneath there are your Christmas greetings in a modern whimsical elegant script. Below is your family name and year in a simple typography. The card is framed on the bottom by lovely watercolor greenery: eucalyptus and red winter berries. The reverse of the card features the same botanical motif as well as your custom Christmas wishes! Create your own perfect Christmas greeting card by clicking on the ´´Personalize´´ button and changing the pictures and wording to your own!

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8006 total 5-star reviews1179 total 4-star reviews214 total 3-star reviews88 total 2-star reviews108 total 1-star reviews
9,595 Reviews
4 out of 5 stars rating
By James C.December 4, 2024Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Beautiful cards, I am very pleased with the results. A few friends and family have already texted me to tell me how beautiful this year's card is, simple yet elegant. I will definitely buy my Christmas cards from Zazzle in the future. .
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Angela V.January 6, 2024Verified Purchase
Zazzle Reviewer Program
Arrived on time and exactly how I designed them. I started with a default card and made subtle changes to font and size. They were simple but so beautiful and perfect to top our cookie boxes. Exactly our style and we couldn’t find anything close to this look anywhere else. Amazing quality on the printing. Thick and sturdy card stock and beautiful envelopes too
5 out of 5 stars rating
By Zita W.August 1, 2023Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
This simple card was a bit hit among my family and friends for Christmas 2022. Everyone loved it. The quality of the print was good. Please note you need to give clear photos to get a good print.

Tags

Flat Holiday Cards
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays
All Products
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays

Other Info

Product ID: 256903441749600233
Designed on 2023-09-26, 11:53 PM
Rating: G