Tap / click on image to see more RealViewsTM
CA$22.90
per mouse pad
 

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Qty:
Enter Information

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.49 cm l x 19.68 cm w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 23.49 cm x 19.68 cm

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Chic vintage look with a customizable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating4.7K Total Reviews
4211 total 5-star reviews384 total 4-star reviews73 total 3-star reviews26 total 2-star reviews26 total 1-star reviews
4,720 Reviews
Reviews for similar products
5 out of 5 stars rating
By Zach_ R.January 22, 2022Verified Purchase
Mousepad
Zazzle Reviewer Program
Easy to use interface for creating your own design on the mousepad. The quality is great, just wish it was a little bigger. I ordered other mouse pads on this site before this one but the image on them didn't match up to what I customized it to. Need to make sure that your customed image is within the green lines. However, they fixed my problem by giving me another chance at creating another mousepad for free. Great customer service! The colors are on point and it feels like a durable mousepad. Just make sure your custom image fits within the green lines so it doesn't get cut out around the edges.
5 out of 5 stars rating
By Kimberlee T.October 7, 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
I almost regretted buying this thinking that $16 couldn't possibly be very good quality but i was wrong. Im now shocked that it is so cheap because it is a really good quality mouse pad. thank you zazzle. the printing was perfect
4 out of 5 stars rating
By Natasha H.April 15, 2016Verified Purchase
Mousepad
Creator Review
Very good product apart from the unpleasant odor upon arrival. Must be the chemicals used for printing the image. I am sensitive to smells. Printing turned out as well as the photo. I was very pleased.

Tags

Mousepads
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 144388314163988114
Designed on 2012-10-29, 2:02 PM
Rating: G