Tap / click on image to see more RealViewsTM
Sale Price CA$3.72.  
Original Price CA$4.95 per card
You save 25%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.30
+CA$1.05

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Chic vintage look with a customizable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating69.6K Total Reviews
61654 total 5-star reviews5712 total 4-star reviews1005 total 3-star reviews480 total 2-star reviews746 total 1-star reviews
69,597 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim B.February 18, 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I was very impressed with the quality of the invitations especially when I like to look and touch any product I buy. They are very elegant and good quality. They arrive exactly like promised and packaged well as there was no damage. Great Job!! Very satisfied with the quality. Job well done!
5 out of 5 stars rating
By M.December 22, 2020Verified Purchase
Zazzle Reviewer Program
These personalized Christmas cards were so pretty and the added touch of making it personal was just so perfect! The printing was clear and legible, no bleeding of the ink!
Original product
5 out of 5 stars rating
By N.August 12, 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I am so happy with Zazzle and the designs available for customisation are so unique and classy. Customer service also is great. Highly recommended! The printing as expected. Excellent quality!

Tags

All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 161983976605672037
Designed on 2012-10-29, 2:02 PM
Rating: G