Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
CA$68.90
per clock
 

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
27.3 cm Square Acrylic
-CA$7.90
-CA$7.65
-CA$7.65
-CA$7.65

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Square Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 27.3 cm L x 27.3 cm H
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.5K Total Reviews
2894 total 5-star reviews391 total 4-star reviews80 total 3-star reviews42 total 2-star reviews63 total 1-star reviews
3,470 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sue A.February 13, 2021Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
I love it and now my parents will - big day ahead for them. it was vert clear - looked just lovely
5 out of 5 stars rating
By N.January 22, 2022Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Zazzle Reviewer Program
Glad I found this online. Our cabin needed a clock yet, and we are very happy with it. Also knowing we helped a ‘small family business’ is a bonus as well. Thank you very much. Just what I was expecting Sorry the pic isn’t the greatest
5 out of 5 stars rating
By K.May 31, 2021Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
This personalized clock turned out so beautiful, my folks loved such a thoughtful gift:). The photos all turned out perfect:)

Tags

Wall Clocks
All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Designed on 2025-09-04, 12:24 PM
Rating: G