Tap / click on image to see more RealViewsTM
CA$16.95
CA$5.65 per sheet of tissue paper
 

Distressed Sun Decoupage Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 45.72 cm x 60.96 cm

Make all of your gifts perfectly unique with personalised tissue paper. Give your gifts a sweet, personal touch with designs, photos, images, and text printed on this gift wrapping essential. Impress your friends and family with your amazing style!

  • Please note that this size tissue arrives folded
  • Dimensions: 45.72 cm L x 60.96 cm W unfolded
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Distressed Sun Decoupage Tissue Paper

Distressed Sun Decoupage Tissue Paper

Unleash the warmth and allure of the sun with this exquisite Distressed Sun Decoupage Tissue Paper. Its vintage-inspired design evokes a sense of nostalgic charm and tranquility. Crafted with meticulous detail, the tissue paper features a distressed sun motif, rendered in ethereal shades of gold and amber. The aged effect lends an air of timelessness, inviting you to create projects that resonate with both the past and present. Whether you’re a seasoned artist, a home décor enthusiast, or simply seeking to add a touch of warmth to your life, this high-quality tissue paper is the perfect companion. Its versatility allows you to transform ordinary surfaces into extraordinary works of art. -Distressed sun design for a vintage esthetic -Shimmering gold and amber hues add depth and warmth -Premium tissue paper ensures durability and ease of use -Ideal for découpage, mixed media, scrapbooking, and other creative projects.

Customer Reviews

4.8 out of 5 stars rating3K Total Reviews
2732 total 5-star reviews155 total 4-star reviews47 total 3-star reviews25 total 2-star reviews44 total 1-star reviews
3,003 Reviews
Reviews for similar products
5 out of 5 stars rating
By Darlene B.December 14, 2021Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
This decoupage paper looks amazing on the old cedar trunk I refinished. It has made the trunk a special gift for my grandson. The design itself turned out much better than I expected. I am very pleased.
5 out of 5 stars rating
By Lucy B.December 20, 2021Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Great quality decoupage paper! I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more. I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more.
5 out of 5 stars rating
By Tessa M.December 23, 2021Verified Purchase
Zazzle Reviewer Program
Gorgeous paper, a little heavier than traditional decoupage tissue, but it worked beautifully on my project nonetheless. Elegant - simple- tres chic! The printing turned out beautifully, it is consistent throughout the entire print with a somewhat faded or mottled coloration. I am in love with this paper.
Original product

Tags

Tissue Paper
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal
All Products
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal

Other Info

Product ID: 256055763715191733
Designed on 2024-08-16, 6:13 PM
Rating: G