Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
CA$16.90
per notebook
 

Daisy Chain - Notebook (Bright Pink)

Qty:

    Other designs from this category

    About Notebooks

    Sold by

    Style: 16.51 cm x 22.22 cm Classic Notebook

    Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

    • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
    • Cover printed in vibrant, sharp colour
    • 80 black & white lined pages
    • College ruled
    • Lay flat spiral binding
    This product is recommended for ages 8+..
    Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

    About This Design

    The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
    Daisy Chain - Notebook (Bright Pink)

    Daisy Chain - Notebook (Bright Pink)

    A modern take on a sweet floral motif, Daisy Chain feels both playful and refined. The repeating pattern brings movement and rhythm, while the high-contrast palette keeps it crisp and graphic. Designed with a Scandinavian sensibility—simple, bold, and intentional—this adds personality without feeling overdone. It’s the kind of piece that stands out on its own but still works effortlessly with everything else you carry. Lighthearted, modern, and a little unexpected—this is everyday design done right.

    Customer Reviews

    4.8 out of 5 stars rating1.8K Total Reviews
    1527 total 5-star reviews189 total 4-star reviews42 total 3-star reviews27 total 2-star reviews15 total 1-star reviews
    1,800 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By ana g.March 1, 2019Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    I got these for my 2 girls because they love little monsters, so they could use it for notes for school. They loved them :). Printing was as shown (very good).
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By AnnMarie P.January 16, 2023Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    I ordered this for a colleague who was recently promoted to Principal. The quality was excellent and the product arrived shortly after submitting the order. The look of the cover is terrific. Printing was clear and the lettering looked great. Personalized name was spelled correctly.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Nancy E.March 4, 2018Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    I love journals and notebooks, so I was very excited to be able to order one using a piece of my artwork as the cover design. It turned out perfect, the quality is A+ and I would definitely order this product again. The print quality is superb. I can say this because the cover is my own digital design, so I have the original artwork to compare the colors. The colors are exact to the artwork. I am very impressed with the print quality and will be ordering more with different designs.

    Tags

    Notebooks
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine
    All Products
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine

    Other Info

    Product ID: 256029940409343732
    Designed on 2026-03-27, 3:26 PM
    Rating: G