Tap / click on image to see more RealViewsTM
CA$3.52
per sticker
 

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 5.08 cm L x 6.35 cm H
  • Design Area: 5.08 cm L x 5.08 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

🥞🐰💖✨🥞🐰💖✨ "Drift into a sweet dream with this adorable baby bunny, snuggled up in its cute pajamas right on top of a giant, fluffy pancake! 🐰🥞 This design embodies pure comfort and ultimate dreamy kawaii charm, perfect for pancake lovers, sleepy animal fans, and anyone who adores unique cute art with a heartwarming, cozy touch. Fully customizable for any Zazzle product, it makes a perfect gift or a lovely treat for yourself! Let this sweet scene bring warmth and smiles to your world! 💖 This design is fully customizable - add your own text or image to make it uniquely yours!" 🥞🐰💖✨ "Schweben Sie in süße Träume mit diesem bezaubernden Babyhäschen, das sich in seinem niedlichen Schlafanzug direkt auf einem riesigen, flauschigen Pfannkuchen einkuschelt! 🐰🥞 Dieses Design verkörpert puren Komfort und ultimativen verträumten Kawaii-Charme, perfekt für Pfannkuchenliebhaber, schläfrige Tierfans und alle, die einzigartige niedliche Kunst mit einem herzerwärmenden, gemütlichen Touch lieben. Vollständig anpassbar für jedes Zazzle-Produkt, ist es ein perfektes Geschenk oder eine nette Belohnung für Sie selbst! Lassen Sie diese süße Szene Wärme und Lächeln in Ihre Welt bringen! 💖 Dieses Design ist vollständig anpassbar - fügen Sie Ihren eigenen Text oder Ihr eigenes Bild hinzu, um es einzigartig zu machen!" 🥞🐰💖✨ "Plongez dans un doux rêve avec cet adorable bébé lapin, confortablement installé dans son joli pyjama directement sur une immense et moelleuse crêpe ! 🐰🥞 Ce design incarne le confort pur et le charme kawaii onirique ultime, parfait pour les amoureux des crêpes, les fans d'animaux endormis, et tous ceux qui adorent l'art mignon unique avec une touche réconfortante et douillette. Entièrement personnalisable pour tout produit Zazzle, c'est un cadeau parfait ou une jolie gâterie pour vous-même ! Laissez cette douce scène apporter chaleur et sourires à votre monde ! 💖 Ce design est entièrement personnalisable - ajoutez votre propre texte ou image pour le rendre unique !" 🥞🐰💖✨ "Naviga in un dolce sogno con questo adorabile coniglietto, accoccolato nel suo grazioso pigiama proprio in cima a un enorme e soffice pancake! 🐰🥞 Questo design incarna il comfort puro e il massimo del fascino kawaii sognante, perfetto per gli amanti dei pancake, i fan degli animali assonnati e chiunque adori l'arte unica e carina con un tocco commovente e accogliente. Completamente personalizzabile per qualsiasi prodotto Zazzle, è un regalo perfetto o una deliziosa coccola per te stesso! Lascia che questa dolce scena porti calore e sorrisi nel tuo mondo! 💖 Questo design è completamente personalizzabile: aggiungi il tuo testo o la tua immagine per renderlo unico!" 🥞🐰💖✨ "A dreamlike scene where a baby rabbit in a cute pajamas is sitting on a fluffy pancake! 🐰🥞 This design embodies the ultimate comfort and dream kawaii charm, perfect for pancake lovers, good-night animal fans, and everyone who loves unique and cute art that is heartwarming! You can customize any item in Zazzle, so it's perfect for perfect gifts and a nice reward for yourself! May this sweet scene bring warmth and smile to your world! 💖 This design is freely customizable - you can add your text or pictures to make it your only special item! " #PancakeBunny, #PajamaCute, #FluffyPancake, #KawaiiArt, #SweetDreams, #AdorableAnimal, #DreamyCute, #Yumekawaii, #CozyVibes, #BedtimeBunny #AntiqueCafe, #KawaiiArt, #CuteRabbit, #SweetTreats, #FluffyBunny, #DreamyCute, #Yumekawaii, #VintageStyle, #ElegantCute .🌟🐰#YUMEKWAAII, #KawaiiRabbit, #MagicalPlay, #DreamyPastel, #FantasyCute, #UnicornLover, #AdorableAnimal, #SweetFriends #DreamyPastel, #CelestialArt, #CuteSpace, #StarryNight, #RetroKawaii, #HeartPalette, #KawaiiMakeup, #SparkleBunny, #PinkAesthetic, #GlitterArt, #Gemstone, #SparkleKawaii, #DreamyPastel, #LuxuryCute, #JewelLover, #BrilliantArt

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
894 total 5-star reviews71 total 4-star reviews28 total 3-star reviews22 total 2-star reviews75 total 1-star reviews
1,090 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
pancakebunnypajamacutefluffypancakekawaiiartsweetdreamsadorableanimaldreamycuteyumekawaiicozyviousbedtimebunny
All Products
pancakebunnypajamacutefluffypancakekawaiiartsweetdreamsadorableanimaldreamycuteyumekawaiicozyviousbedtimebunny

Other Info

Product ID: 256358561901776110
Designed on 2025-06-09, 6:54 AM
Rating: G