Tap / click on image to see more RealViewsTM
CA$5.05
per sticker
 

Cute Kawaii Hamster Custom

4.5 out of 5 stars rating
1148 Total Reviews |
by
Qty:
Sticker Sheet Size
Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cute Kawaii Hamster Custom

Cute Kawaii Hamster Custom

Lovely kawaii style hamster with little flowers on the sides. Kawaii means "cute" and it sure is! You can customize the background colour and the text to your liking..and because it's a template, you can add even more text or images. Check the shop for matching items and other items for babies, adults, home and office....etc! If you need any help, or if you have any questions or requests, feel free to contact me through the shop :)
Opus Posh
Bronze
Artwork designed by
United States
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
920 total 5-star reviews74 total 4-star reviews28 total 3-star reviews32 total 2-star reviews94 total 1-star reviews
1,148 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristin R.January 2, 2020 • Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023 • Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.

Tags

Custom-Cut Vinyl Stickers
cutefunnyhamsterhammiepetanimalanimalspetskawaiijapanese
All Products
cutefunnyhamsterhammiepetanimalanimalspetskawaiijapanese

Other Info

Product ID: 256540641427816768
Designed on 2020-03-02, 4:55 PM
Rating: G