Tap / click on image to see more RealViewsTM
CA$10.55
per set of 6 labels
 

Cute Cat Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-CA$1.75
-CA$3.55
+CA$7.10
+CA$7.10
+CA$7.10
+CA$7.10
+CA$7.10

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Cute Cat Wine Label

Cute Cat Wine Label

Cute cats are some of the most enchanting and irresistible creatures on the planet. With their soft fur, big, expressive eyes, and playful nature, they have the ability to capture the hearts of people young and old.

Customer Reviews

4.8 out of 5 stars rating159 Total Reviews
140 total 5-star reviews9 total 4-star reviews4 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
159 Reviews
Reviews for similar products
5 out of 5 stars rating
By Loredana G.June 28, 2023Verified Purchase
Water Bottle Label (21 cm x 5.4 cm)
Zazzle Reviewer Program
These turned out great for my daughter's bridal shower. I removed the paper label from the bottle and attached this sticker. Printing is beautiful.
5 out of 5 stars rating
By Rita D.November 10, 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I bought these labels for my candle jars and they were perfect! Good quality. Able to peel them off without residue on the jar. Nice matte finish. Perfect! Exactly what was ordered
5 out of 5 stars rating
By Chelsea F.December 22, 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Looked great, nice quality. Really nice, nice feel

Tags

Food and Beverage Label Sets
catcutekittenfunnykittyanimalcatspetkawaiianimals
All Products
catcutekittenfunnykittyanimalcatspetkawaiianimals

Other Info

Product ID: 256632621185467653
Designed on 2023-08-01, 1:25 AM
Rating: G