Tap / click on image to see more RealViewsTM
CA$5.70
per sticker
 

Cute adorable kawaii animals sticker set

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cute adorable kawaii animals sticker set

Cute adorable kawaii animals sticker set

Cute adorable kawaii animals sticker set.

Customer Reviews

4.7 out of 5 stars rating56 Total Reviews
50 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
56 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.April 14, 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Loved the product! I was looking for a unique gift and found it here. Great - nice and clear!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mindy B.November 12, 2019Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I bought these decals for my daughter - she's personalized just about every water bottle she owns, so I thought it would be fun to add some acro love to the mix. They look great, and have held up in the dishwasher and through hand washing. The decal quality is great. The colors are rich and vibrant. There's a perfect border on each decal, too.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.October 24, 2022Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This is a great product. The design is beautiful, and it went on so easily to my laptop. I love it. I have had so many compliments. It is bright and really shows off the design. The printing was great. It looks just like the picture that I ordered from. Nice and bright.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
cuteadorablecuddlykawaiianimalsstickerfriendsfamily
All Products
cuteadorablecuddlykawaiianimalsstickerfriendsfamily

Other Info

Product ID: 256966428736239911
Designed on 2025-06-24, 12:53 PM
Rating: G