Tap / click on image to see more RealViewsTM
Sale Price CA$2.84.  
Original Price CA$3.78 per card
You save 25% ends today

Custom Enchanted Daisy Baby Shower Thank You Card

Collection
Qty:
Squared
+CA$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.90
-CA$0.30

Other designs from this category

Shop this collection

Dylan Ashlay Ramjee
Magical Cute Daisy Baby ShowerDesigned by Dylan Ashlay Ramjee
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Flat Thank You Cards

Sold by

Size: 8.9 cm x 12.7 cm

For all the ways you say thank you, we've got a custom thank you card just for you.

  • Dimensions: 8.9 cm L x 12.7 cm H (portrait); 12.7 cm L x 8.9 cm H (landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Custom Enchanted Daisy Baby Shower Thank You Card

Custom Enchanted Daisy Baby Shower Thank You Card

Express your gratitude with our "Custom Enchanted Daisy Baby Shower" thank you cards. These beautifully designed cards feature a sweet pastel daisy motif, making them a lovely way to show your appreciation. Customize the cards with your own heartfelt message, letting your guests know how much their presence meant to you. These thank you cards are the perfect finishing touch to your baby shower, allowing you to express your thanks in a personal and charming way. Your guests will cherish the thoughtful gesture and the beautiful design.

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3255 total 5-star reviews271 total 4-star reviews66 total 3-star reviews31 total 2-star reviews109 total 1-star reviews
3,732 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tina A.December 22, 2024Verified Purchase
Flat Thank You Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Beautiful and excellent quality! Canada Post made this order become delayed but I eventually got them and mailed them out right away. Thanks so much! .
2 out of 5 stars rating
By AnonymousJuly 10, 2024Verified Purchase
Flat Thank You Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
The cards are nice, smaller than I thought, and they came mis printed in my opinion. The one side of it had a white line down the photo and therefore set the writing off centre on the back. I wanted to return but I already waited for them and want these sent out for my wedding thank you, so I’m dealing with it. . The card printed a line and through the entire thing off centre, not happy but need to send them out so cannot reorder Also the print has it so you flip over and it’s upside down, it logically doesn’t make sense to flip up and down instead of left to right or right to left.
5 out of 5 stars rating
By Kyler T.August 14, 2021Verified Purchase
Flat Thank You Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared, Print Quality: Standard, Envelopes: White
Zazzle Reviewer Program
Such an easy, user friendly design portal. Shipping was fast and everything arrived earlier than expected. Highly recommend for thank you cards etc etc!! Picture and printing turned out as shown on the site and quality of the photo on the thank you cards was very high quality!!

Tags

Flat Thank You Cards
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers
All Products
watercolordaisydaisy baby showerfloral baby showerwhite daisywhimsicalmagicalpastelsimpleflowers

Other Info

Product ID: 256515102053315731
Designed on 2024-06-16, 3:06 AM
Rating: G