Tap / click on image to see more RealViewsTM
CA$4.90
per sticker
 

Cozy Bird Nest Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cozy Bird Nest Sticker

Cozy Bird Nest Sticker

A tiny bird cozied up in its nest, tucked among blooms and branches—a picture-perfect scene of nature’s embrace!

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
912 total 5-star reviews71 total 4-star reviews28 total 3-star reviews27 total 2-star reviews81 total 1-star reviews
1,119 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
snugglynestbirdblissnatureshugfeatheredfriendbloomandbrancheswoodlandcharmcozybirdpeacefulperchwildlifewhimsyspringtimeserenity
All Products
snugglynestbirdblissnatureshugfeatheredfriendbloomandbrancheswoodlandcharmcozybirdpeacefulperchwildlifewhimsyspringtimeserenity

Other Info

Product ID: 256400337654930539
Designed on 2025-04-07, 2:38 PM
Rating: G