Tap / click on image to see more RealViewsTM
CA$64.95
per pillow
 

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Qty:
40 cm Throw Pillow
+CA$11.95
+CA$32.10

About Pillows

Sold by

Size: 40 cm Throw Pillow

Accent your home with custom pillows from Zazzle and make yourself the envy of the neighborhood. Made from high-quality Simplex knit fabric, these 100% polyester pillows are soft and wrinkle-free. The heavyweight stretch material provides beautiful color definition for your design while also being the perfect complement to your couch!

  • Dimensions: 16" x 16" (40.6 cm x 40.6 cm)(square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zipper enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16"(40.6 cm x 40.6 cm). For best results please add 0.59"(1.5 cm) bleed.

About This Design

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

This throw pillow features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a timeless, heritage‑inspired touch that works beautifully in both modern and traditional interiors. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it an easy accent for sofas, beds, chairs, or cozy reading nooks

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8315 total 5-star reviews901 total 4-star reviews201 total 3-star reviews75 total 2-star reviews112 total 1-star reviews
9,604 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousJanuary 17, 2016Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Creator Review
This pillow was produced quickly and shipped right on time !. Great quality pillow, we purchased the Grade A Cotton version. Looking foward to displaying this pillow for years to come. The colors were exactly as displayed online, vibrant and crisp
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie S.July 14, 2024Verified Purchase
Throw Pillow, 50 cm Throw Pillow
Love the fabric and the vibrant colours. The only reason I did not give it 5 stars is because the pillows were slightly smaller than 41 x 41 cm. I was disappointed with that. The printing turned out excellent!
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.June 20, 2020Verified Purchase
Zazzle Reviewer Program
This was an excellent gift for my daughter’s birthday. She loves it! And it arrived before the big day😊 Excellent quality. Excellent! It looks just like Neuman.
Original product

Tags

Pillows
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow
All Products
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow

Other Info

Product ID: 256005583188580567
Designed on 2025-09-09, 4:48 AM
Rating: G