Tap / click on image to see more RealViewsTM
CA$64.95
per pillow
 

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Qty:
Throw Pillow 40.6 x 40.6 cm
+CA$11.95
+CA$32.10

About Pillows

Sold by

Size: Throw Pillow 40.6 x 40.6 cm

Accent your home with custom pillows from Zazzle and make yourself the envy of the neighborhood. Made from high-quality Simplex knit fabric, these 100% polyester pillows are soft and wrinkle-free. The heavyweight stretch material provides beautiful color definition for your design while also being the perfect complement to your couch!

  • Dimensions: 16" x 16" (40.6 cm x 40.6 cm)(square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zipper enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16"(40.6 cm x 40.6 cm). For best results please add 0.59"(1.5 cm) bleed.

About This Design

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

Classic Plaid Tartan Pattern-Navy & White Throw Pillow

This throw pillow features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a timeless, heritage‑inspired touch that works beautifully in both modern and traditional interiors. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it an easy accent for sofas, beds, chairs, or cozy reading nooks

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8287 total 5-star reviews900 total 4-star reviews198 total 3-star reviews74 total 2-star reviews109 total 1-star reviews
9,568 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousJanuary 17, 2016Verified Purchase
Throw Pillow, Throw Pillow 40.6 x 40.6 cm
Creator Review
This pillow was produced quickly and shipped right on time !. Great quality pillow, we purchased the Grade A Cotton version. Looking foward to displaying this pillow for years to come. The colors were exactly as displayed online, vibrant and crisp
5 out of 5 stars rating
By Debbie S.July 14, 2024Verified Purchase
Throw Pillow, Throw Pillow 50.8 x 50.8 cm
Love the fabric and the vibrant colours. The only reason I did not give it 5 stars is because the pillows were slightly smaller than 41 x 41 cm. I was disappointed with that. The printing turned out excellent!
5 out of 5 stars rating
By S.June 20, 2020Verified Purchase
Zazzle Reviewer Program
This was an excellent gift for my daughter’s birthday. She loves it! And it arrived before the big day😊 Excellent quality. Excellent! It looks just like Neuman.
Original product

Tags

Pillows
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow
All Products
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow

Other Info

Product ID: 256005583188580567
Designed on 2025-09-09, 4:48 AM
Rating: G