Tap / click on image to see more RealViewsTM
CA$53.20
per All-Over Print Apron
 

Classic Plaid Tartan Pattern-Navy & White Apron

Qty:
Black
Medium
-CA$6.95
+CA$4.65

Other designs from this category

About All-Over Print Aprons

Sold by

Size: All-Over Print Apron, Medium 66.04 cm x 76.2 cm

Whether you are cooking at home, hosting a summer BBQ, or creating arts & crafts- do so in style with our fully customizable aprons! Made of a top quality polyester, our fully sublimation designs will definitely make a great impression on your guests. Available in 3 sizes for adults, young adults, children- basically everyone! Each size is adorned with a sublimated neck strap and adjustable waist string to ensure the best design results.

  • Dimensions: 76.2 cm length x 66.04 cm width
  • Waist String 87.63 cm
  • Material: 100% Polyester
  • Full Dye Sublimation
  • One Side Printing Available
  • Machine wash in cold water on gentle cycle with mild detergent. Do not bleach or iron. Line dry.

About This Design

Classic Plaid Tartan Pattern-Navy & White Apron

Classic Plaid Tartan Pattern-Navy & White Apron

This apron features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design blends heritage charm with modern versatility, making it a stylish and functional choice for cooking, baking, crafting, or hosting. Its repeating grid motif adapts beautifully to any colour palette — from understated neutrals to bold, high‑contrast combinations — ensuring it complements a wide range of personal styles and kitchen décor

Customer Reviews

4.7 out of 5 stars rating671 Total Reviews
585 total 5-star reviews44 total 4-star reviews6 total 3-star reviews8 total 2-star reviews28 total 1-star reviews
671 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joy P.December 22, 2024Verified Purchase
All-Over Print Apron, Medium
Absolutely beautiful! The quality is amazing arrived quickly! We definitely purchase from them again.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Miss R.November 19, 2023Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
awesome colours, aligned and very excited to give this as a gift. fabulous colours, get aligning of the print.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Leo P.November 6, 2022Verified Purchase
All-Over Print Apron, Large
Zazzle Reviewer Program
Great material and fits just as I expected. Could not have asked for better print out. Just as I expected

Tags

All-Over Print Aprons
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron
All Products
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron

Other Info

Product ID: 256443526394758011
Designed on 2025-09-12, 5:24 PM
Rating: G