Tap / click on image to see more RealViewsTM
CA$89.40
per fleece blanket
 

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 152.4 cm

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

This fleece blanket features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design brings a timeless, heritage‑inspired look that works beautifully in both modern and traditional spaces. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it a stylish accent for bedrooms, living rooms, or anywhere you want to add warmth and character

Customer Reviews

4.8 out of 5 stars rating3.5K Total Reviews
3044 total 5-star reviews344 total 4-star reviews65 total 3-star reviews47 total 2-star reviews29 total 1-star reviews
3,529 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.February 13, 2021Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
Beautiful product of. Amazing good quality picture were clear
5 out of 5 stars rating
By Ashley H.December 11, 2021Verified Purchase
Fleece Blanket, Large 152.4 cm x 203.2 cm
Zazzle Reviewer Program
Product is great quality, arrived on time, it will be enjoyed for a long time!! Exactly what I ordered
5 out of 5 stars rating
By Gervanne B.December 30, 2017Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
I absolutely love it. It is amazing, and warm, and soft, softer I would have ever expected, it does not look cheap at all, it is just the best blanket ever, I love wrapping my self in it. I will probably buy some for my friends. The printing is just as perfect, it is very readable, the colours came out perfectly, with the right nuances and gradients... I love everything about it.

Tags

Fleece Blankets
classicplaidfleeceblankettartanpatternthrowblanketgeometriccheckfleecetimelessplaidhomedecormoderntraditionalblanketstructuredgridpatternversatilepatternthrowstatementplaidblanketsymmetricalcheckdesigndarknavywhiteplaidfleeceblanket
All Products
classicplaidfleeceblankettartanpatternthrowblanketgeometriccheckfleecetimelessplaidhomedecormoderntraditionalblanketstructuredgridpatternversatilepatternthrowstatementplaidblanketsymmetricalcheckdesigndarknavywhiteplaidfleeceblanket

Other Info

Product ID: 256183248903541793
Designed on 2025-09-09, 2:12 AM
Rating: G