Tap / click on image to see more RealViewsTM
CA$8.55
per set of 4 labels
 

Classic Geo pattern black and white personalized Water Bottle Label

Qty:
Water Bottle Label (21 cm x 5.4 cm)
+CA$4.30
+CA$4.30
+CA$2.15
+CA$12.95
+CA$12.95
+CA$4.30
+CA$12.95
+CA$12.95
+CA$12.95
+CA$4.30

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Water Bottle Label (21 cm x 5.4 cm)

Easily customize a water bottle and make it 100% your own. Perfect for weddings, birthday parties, and baby showers.

  • Dimensions: 20.9 cm x 5.4 cm (8.25" x 2.125")
  • Each set includes 4 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 20.3 cm x 5.4 cm (8.01" x 2.14"). For best results please add 0.3 cm (0.12")bleed.

About This Design

Classic Geo pattern black and white personalized Water Bottle Label

Classic Geo pattern black and white personalized Water Bottle Label

Perfect for your small bussiness or event. This would also be a perfect choice for an aniversary party or a reunion. Easy to customize this template with its classic script allows you to add your name logo or even event details in the second line of text.

Customer Reviews

4.7 out of 5 stars rating155 Total Reviews
136 total 5-star reviews9 total 4-star reviews4 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
155 Reviews
Reviews for similar products
5 out of 5 stars rating
By Loredana G.June 28, 2023Verified Purchase
Water Bottle Label (21 cm x 5.4 cm)
Zazzle Reviewer Program
These turned out great for my daughter's bridal shower. I removed the paper label from the bottle and attached this sticker. Printing is beautiful.
5 out of 5 stars rating
By Rita D.November 10, 2022Verified Purchase
Food Container Label (5.1 cm x 7.6 cm)
Zazzle Reviewer Program
I bought these labels for my candle jars and they were perfect! Good quality. Able to peel them off without residue on the jar. Nice matte finish. Perfect! Exactly what was ordered
5 out of 5 stars rating
By Chelsea F.December 22, 2022Verified Purchase
Food Container Label (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
Looked great, nice quality. Really nice, nice feel

Tags

Food and Beverage Label Sets
blackwhiteclassicnametemplateaddyourpatternbusinessprofessionalscript
All Products
blackwhiteclassicnametemplateaddyourpatternbusinessprofessionalscript

Other Info

Product ID: 256154423716700481
Designed on 2019-03-09, 6:56 PM
Rating: G