Tap / click on image to see more RealViewsTM
CA$3.20
per sticker
 

Chill Chocolate Milkshake Pun

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 5.08 cm L x 6.35 cm H
  • Design Area: 5.08 cm L x 5.08 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Chill Chocolate Milkshake Pun

Chill Chocolate Milkshake Pun

Cute cartoon chocolate shake mascot with the text, "chill." Chocolate milkshake with whipped cream and a cherry on top cartoon.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
904 total 5-star reviews71 total 4-star reviews28 total 3-star reviews27 total 2-star reviews81 total 1-star reviews
1,111 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
chocolateshakemilkshakecherrywhipped creamfoodice creampunchillgenerativecontent
All Products
chocolateshakemilkshakecherrywhipped creamfoodice creampunchillgenerativecontent

Other Info

Product ID: 256527388700198500
Designed on 2024-03-18, 5:56 PM
Rating: G