Tap / click on image to see more RealViewsTM
CA$38.00
per shirt
 

Cherry Hearts Cute and Funny T-Shirt

Qty:
Basic T-Shirt
+CA$14.90
+CA$20.65
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+CA$9.35
+CA$9.35
+CA$9.35

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Cherry Hearts Cute and Funny  T-Shirt

Cherry Hearts Cute and Funny T-Shirt

Sweet, playful, and full of charm, this Cherry Hearts T‑shirt brings a fresh twist to classic Valentine style. Featuring a cute cherry motif paired with heart‑shaped accents, it’s perfect for anyone who loves fun, flirty designs with a touch of retro sweetness. Whether you’re dressing for Valentine’s Day, gifting someone special, or simply adding a little love‑themed flair to your everyday wardrobe, this tee delivers cheerful vibes and effortless style.

Customer Reviews

4.5 out of 5 stars rating15.2K Total Reviews
10781 total 5-star reviews2914 total 4-star reviews846 total 3-star reviews400 total 2-star reviews266 total 1-star reviews
15,207 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pam S.October 12, 2025Verified Purchase
Gave it to my daughter as a gift. She loved it. Next time I would order it on white for a crisper image.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.February 6, 2023Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
I like that this turned out exactly as I had hoped. My daughter was missing her father (he passed away recently), and this picture of her with him delighted her! The print job was excellent and the colors were true to the original.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diana W.June 6, 2021Verified Purchase
Basic T-Shirt, White, Small
Zazzle Reviewer Program
It came on time and as described. The fit is perfect and I like the quality as well. I love it and #OrangePillPod Telegram group loves it too :). Print was a bit lighter than expected, but that doesn't bother me at all.

Tags

All Products
cherryheartfunkycutesweetvalentinegraphicflirtycherries

Other Info

Product ID: 256124709515819054
Designed on 2026-02-06, 12:27 PM
Rating: G