Tap / click on image to see more RealViewsTM
Sale Price CA$32.24.  
Original Price CA$46.05 per pack of 100
You save 30%

Cherries Business Cards

Qty:
Squared
+CA$10.55
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-CA$8.90
-CA$8.90
+CA$8.85
+CA$8.85
+CA$8.85
+CA$8.85
+CA$8.85
+CA$8.85
+CA$24.70

Other designs from this category

About Business Cards

Sold by

Size: Canadian Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating38.8K Total Reviews
32537 total 5-star reviews3875 total 4-star reviews950 total 3-star reviews577 total 2-star reviews828 total 1-star reviews
38,767 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lori B.May 18, 2022Verified Purchase
Business Card, Size: Canadian Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The cards turned out lovely! Just enough colour and design to look good and be easy to read . Sturdy card stock as well. The soft pink watercolour looks really pretty on it! Printing is very nice. It’s clear and well designed
5 out of 5 stars rating
By Marie S.July 2, 2022Verified Purchase
Business Card, Size: Mighty, 3.5" x 2.5",Paper: Signature Matte, Corners: Rounded
Zazzle Reviewer Program
I am so happy with these custom earring card backs. The process of designing then was easy and straightforward. There was an error with my initial order due and they refunded me and printed again right away. My cards are sleek, professional and perfect for my small business. They arrive promptly. I am very pleased to also be supporting other independent creatives like myself.. The print quality was exceptional!
5 out of 5 stars rating
By Carmen R.December 10, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I'm super happy with my cards I always get compliments on them. No complaints they are perfect!!

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Designed on 2008-03-24, 5:47 PM
Rating: G