Tap / click on image to see more RealViewsTM
CA$56.85
per case
 

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Qty:
Enter Information
Barely There
+CA$8.15

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Barely There Apple iPhone 15 Case

This form-fitting, featherlight Case-Mate custom case provides full coverage to your phone while still keeping your device ultra sleek and stylish.

  • Designed for the Apple iPhone 15
  • Slim profile and lightweight
  • Impact resistant, durable hard plastic
  • Case does not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • customise with your images, designs, and text
  • Glossy finish
  • Printed in the USA

About This Design

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Embrace whimsy with this adorable design featuring pink flying pigs against a celestial, starry night sky. The playful motif creates a magical and fun look, perfect for those who love unique and imaginative accessories. The monogram element adds a personalized and stylish touch, making this design both charming and functional. Ideal for adding a touch of fantasy and humour to your everyday items.

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5263 total 5-star reviews844 total 4-star reviews209 total 3-star reviews114 total 2-star reviews120 total 1-star reviews
6,550 Reviews
Reviews for similar products
5 out of 5 stars rating
By Laurie G.February 14, 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Zazzle Reviewer Program
I order a phone case with a picture of my dog every time I get a new phone. I think the quality it great, and easy to fit on the phone and still use buttons. Everything about the design and quality is great, and I love it. The only thing I regret is that I zoomed in to the picture too much, and didn't realize it until I received the the phone case.
from zazzle.com (US)
5 out of 5 stars rating
By Donna S.December 12, 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Creator Review
Very well made and it fit my iPhone perfectly! Turn out exactly how I wanted it. The colors were clear and very sharp.
from zazzle.com (US)
1 out of 5 stars rating
By Lauren W.July 25, 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 15 Pro, Barely There
I received this case just now for my work phone. The image is NOT as pictured, but larger...AND CROOKED. It wraps around the case and that is not what was advertised on my preview. I would like a refund. Image wraps around case and is warped/crooked
from zazzle.com (US)

Tags

Casemate Cases
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift
All Products
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift

Other Info

Product ID: 256691017589660548
Designed on 2024-06-03, 3:43 AM
Rating: G