Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$6.90
per sticker
 

Camper Sticker Vanlife

4.6 out of 5 stars rating
1062 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm L x 11.43 cm H
  • Design Area: 10.16 cm L x 10.16 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Camper Sticker Vanlife

Camper Sticker Vanlife

Expose your passion for camper with my unique "Camper" sticker. This custom vinyl sticker is perfect to add a touch of outdoor adventure to your camping vehicle, tent or other objects. The motif of the sticker shows the essence of the camping, surrounded by the breathtaking nature. The sticker is seamlessly integrated into every style in an elegant black design. With a size of 10.1 cm x 10.1 cm, this sticker is versatile. Decorate your camper, show your love for camping on your tent or give your camping equipment a unique touch. Expose nature and the adventure of camping and let the world know that you are a passionate camper. Get my "camper" sticker now and make your camping experience unmistakable!
Famafami
Artwork designed by
Chemnitz, Sachsen, Germany
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews70 total 4-star reviews25 total 3-star reviews20 total 2-star reviews61 total 1-star reviews
1,062 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
campermobilebeachcampingstickervanlifepalmseamaritime
All Products
campermobilebeachcampingstickervanlifepalmseamaritime

Other Info

Product ID: 256653388845957770
Designed on 2023-06-24, 3:38 PM
Rating: G