Tap / click on image to see more RealViewsTM
CA$33.35
per hat
 

Caduceus Trucker Hat

Qty:
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker Hat

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. customise the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 117.8 cm to 210.2 cm
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 colour combinations
Recommended for ages 6+

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
1953 total 5-star reviews331 total 4-star reviews68 total 3-star reviews18 total 2-star reviews25 total 1-star reviews
2,395 Reviews
Reviews for similar products
5 out of 5 stars rating
By G.November 28, 2017Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
Made this design for a joke cosplay at Blizzcon. It was perfect. Amazing! Very happy with everything.
5 out of 5 stars rating
By Porter C.July 28, 2016Verified Purchase
Trucker Hat, White and Hot Pink
Zazzle Reviewer Program
Got it for my moms birthday and she loves it, looks great! Great, looks awesome and really clear! Definetily buy for a mom birthday present!
5 out of 5 stars rating
By Jason P.May 23, 2020Verified Purchase
Trucker Hat, White and White
Zazzle Reviewer Program
Looks great, design came out great. Fits perfect, and fast shipping. Design was perfect.

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Designed on 2010-04-26, 7:24 AM
Rating: G