Tap / click on image to see more RealViewsTM
CA$38.50
per mug
 

Caduceus Travel Mug

Qty:
Travel/Commuter Mug
-CA$7.70
-CA$6.00
-CA$4.35
+CA$2.30
+CA$7.80
Stainless Steel

Other designs from this category

About Mugs

Sold by

Style: Travel/Commuter Mug

You don’t have to give up a colourful, funny, or attractive design for the function of a top-notch travel mug. Zazzle’s commuter mugs feature a rubber-lined lid for a tight, spill-resistant seal — twist the lid to reveal the sip opening! So, take your favourite photo, monogram, pattern, or cool design with you on your new favourite mug.

  • Dimensions: 414 ml: 6.4 cm diameter base x 8.9 cm diameter x 15.7 cm height
  • Materials: Stainless steel body; plastic handle and base; rubber-lined plastic lid
  • Double-walled stainless steel helps keep your drink hot
  • Do not microwave; hand wash recommended
  • Printed on demand in San Jose, California, USA
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Caduceus Travel Mug

Caduceus Travel Mug

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating22.8K Total Reviews
20069 total 5-star reviews1916 total 4-star reviews347 total 3-star reviews163 total 2-star reviews283 total 1-star reviews
22,778 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joyce T.June 17, 2024Verified Purchase
Travel/Commuter Mug, 444 ml
The mug is well made Could be just a bit larger. The printing on the mug is excellent
5.0 out of 5 stars rating
5 out of 5 stars rating
By c.February 26, 2021Verified Purchase
Travel/Commuter Mug, 444 ml
Zazzle Reviewer Program
Quality product, looks great, pictures are visible amd clear. Printing shows clearly
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.January 22, 2019Verified Purchase
Travel/Commuter Mug, 444 ml
Zazzle Reviewer Program
This mug was exactly as described. I have purchased the stainless steel one before and the white is a nice change (stainless steel inside). I found the lavender purple a little light for my liking but that's my fault. Next time I'll choose a more grapey purple.

Tags

Mugs
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 168682776586601869
Designed on 2010-04-25, 1:17 PM
Rating: G