Tap / click on image to see more RealViewsTM
CA$59.30
per tie
 

Caduceus Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139.7 cm
      • Width: 10.2 cm (at widest point)
    • Printed in vibrant full color
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
    • Dry clean only

    About This Design

    Caduceus Tie

    Caduceus Tie

    Design that makes caduceus motif

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1852 total 5-star reviews331 total 4-star reviews146 total 3-star reviews76 total 2-star reviews124 total 1-star reviews
    2,529 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Margo N.July 8, 2023 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Valta L.August 16, 2020 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much and the print turned out so nice, exactly as I designed it and it was not raised, it looked as though it was part of the overall fabric itself! It was so cool!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Valta L.August 16, 2020 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!

    Tags

    caduceusmedicalsymbolmedicinegreekphysicianswandhermes

    Other Info

    Product ID: 151268738381438883
    Designed on 2010-04-25, 1:10 PM
    Rating: G