Tap / click on image to see more RealViewsTM
CA$42.00
per tie
 

Caduceus Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139.7 cm
    • Width: 10.2 cm (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Caduceus Tie

Caduceus Tie

Design that makes caduceus motif

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1812 total 5-star reviews328 total 4-star reviews136 total 3-star reviews69 total 2-star reviews101 total 1-star reviews
2,446 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margo N.July 8, 2023Verified Purchase
Tie
Zazzle Reviewer Program
That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
1 out of 5 stars rating
By L.January 22, 2026Verified Purchase
Tie
The tie was shown as being black and white on the website but unfortunately it is green and white once I received it. This is false advertisement and I am reporting it. I want my money back. I'm willing to return the tie. It's no good. .
5 out of 5 stars rating
By Laura V.August 16, 2020Verified Purchase
Tie
Zazzle Reviewer Program
I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!

Tags

Ties
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 151268738381438883
Designed on 2010-04-25, 1:10 PM
Rating: G