Tap / click on image to see more RealViewsTM
CA$3.00
per postcard
 

Caduceus Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.30

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Caduceus Postcard

Caduceus Postcard

Design that makes caduceus motif

Customer Reviews

4.9 out of 5 stars rating16.2K Total Reviews
14732 total 5-star reviews1044 total 4-star reviews209 total 3-star reviews84 total 2-star reviews130 total 1-star reviews
16,199 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tina J.March 5, 2019Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
nicely done very clear. print turned out well done
5 out of 5 stars rating
By Denise W.May 1, 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
I'm in love! Just look how sweet these two are! 🥰☘🍀. Great graphics n print! Glossy adds flair! Thanks! ☘🍀
5 out of 5 stars rating
By Denise W.May 1, 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
🐰🐇..Bundorable sweet card! Love the vintage vibe which I wanted! Not a flimsy card! Graphics are awesome n print so good!

Tags

Postcards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 239192120133082062
Designed on 2010-04-25, 1:19 PM
Rating: G