Tap / click on image to see more RealViewsTM
CA$16.35
per keychain
 

Caduceus Keychain

Qty:
Aluminum Circle
+CA$4.30
+CA$4.30
+CA$20.95
+CA$20.95

Other designs from this category

About Keychains

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4286 total 5-star reviews792 total 4-star reviews218 total 3-star reviews118 total 2-star reviews104 total 1-star reviews
5,518 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.December 1, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5 out of 5 stars rating
By Sabah P.April 12, 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
Exactly the same as the picture looks great! Perfect. It looks dark and is the same as the photos.

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Designed on 2010-04-25, 1:42 PM
Rating: G