Tap / click on image to see more RealViewsTM
CA$16.35
per keychain
 

Caduceus Keychain

Qty:
  1. Style

Other designs from this category

About Keychains

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4300 total 5-star reviews793 total 4-star reviews221 total 3-star reviews120 total 2-star reviews106 total 1-star reviews
5,540 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By JoyceDecember 1, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
4.0 out of 5 stars rating
4 out of 5 stars rating
By Joanne G.February 27, 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
They are beautiful but the second batch the border was wider taking away from the picture.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Designed on 2010-04-25, 1:42 PM
Rating: G