Tap / click on image to see more RealViewsTM
CA$16.35
per keychain
 

Caduceus Keychain

Qty:
  1. Style

Other designs from this category

About Keychains

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4304 total 5-star reviews793 total 4-star reviews221 total 3-star reviews121 total 2-star reviews106 total 1-star reviews
5,545 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By JoyceDecember 1, 2024 • Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
4.0 out of 5 stars rating
4 out of 5 stars rating
By Joanne G.February 27, 2026 • Verified Purchase
Metal Circle Keychain, 5.08 cm
They are beautiful but the second batch the border was wider taking away from the picture.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.February 4, 2026 • Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146005941259371004
Designed on 2010-04-25, 1:43 PM
Rating: G