Tap / click on image to see more RealViewsTM
CA$16.35
per keychain
 

Caduceus Keychain

Qty:
Aluminum Circle
+CA$4.30
+CA$4.30
+CA$20.95
+CA$20.95

Other designs from this category

About Keychains

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4289 total 5-star reviews792 total 4-star reviews219 total 3-star reviews119 total 2-star reviews104 total 1-star reviews
5,523 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.December 1, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jonothon H.April 24, 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
I was amazed at both price and quality of the picture on this. Also having both sides allowed me to contrast his age from young to mature for his most special send off. Thank you for making me look like the hero when you guys were. Precise, and exactly centered

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146005941259371004
Designed on 2010-04-25, 1:43 PM
Rating: G