Tap / click on image to see more RealViewsTM
CA$10.10
per keychain
 

Caduceus Keychain

Qty:
Aluminum Circle
+CA$0.90
+CA$0.90
+CA$21.85
+CA$21.85

Other designs from this category

About Keychains

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4272 total 5-star reviews788 total 4-star reviews215 total 3-star reviews117 total 2-star reviews98 total 1-star reviews
5,490 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.December 1, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
5 out of 5 stars rating
By linda f.June 18, 2025Verified Purchase
Premium Round Keychain, Small (3.65 cm)
So cute and this is perfect!!!
from zazzle.com (US)
5 out of 5 stars rating
By Jonothon H.April 24, 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
I was amazed at both price and quality of the picture on this. Also having both sides allowed me to contrast his age from young to mature for his most special send off. Thank you for making me look like the hero when you guys were. Precise, and exactly centered

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146005941259371004
Designed on 2010-04-25, 1:43 PM
Rating: G