Tap / click on image to see more RealViewsTM
Sale Price CA$14.45.  
Original Price CA$17.00 per sheet of 20
You save 15%

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+CA$0.65
+CA$0.65
+CA$0.65

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" diameter, 6 stickers per sheet
    • Small: 1.5" diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23701 total 5-star reviews2245 total 4-star reviews577 total 3-star reviews364 total 2-star reviews547 total 1-star reviews
27,434 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.October 16, 2015Verified Purchase
Zazzle Reviewer Program
The product was perfect for the the little mason jars I have for my daughter's first bday favors.. The quality is great. FYI...Just make sure first where to put them on coz they really sticks good.once you put them on, you can't rearrange/adjust anymore. As I expected, exactly how I've seen them online... Very colorful (well it depends on which design you pick of course)..
5.0 out of 5 stars rating
5 out of 5 stars rating
By Maria S.August 24, 2023Verified Purchase
Zazzle Reviewer Program
I love that I can design what goes on the labels. The design tools are easy to use and the outcome is just what I needed. The printing was perfect and the matte finish is just what I like
5.0 out of 5 stars rating
5 out of 5 stars rating
By N.September 17, 2022Verified Purchase
Zazzle Reviewer Program
High quality stickers. Used it for my son’s first birthday. I used it on the menus i created. Looked perfect! I had a sit down lunch to celebrate. Perfect. Wasn’t blurry. It was clear. Perfect sizing

Tags

Stickers
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217421214359186041
Designed on 2010-04-25, 1:28 PM
Rating: G